PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000441088
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family GRAS
Protein Properties Length: 628aa    MW: 71135.1 Da    PI: 5.5206
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000441088genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS255.32.2e-782626252374
           GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetseknsseelaalklfsevsPilkfshl 96 
                     +  l++Ae v  +++e+a++lL r +  as + +p+qR+++yf++AL++r+   +++++yk  ++s+ s  n  ++   + +f++ +P++ + + 
  MDP0000441088 262 AHIFLAAAEKVGYQQFERANRLLLRCEFAASFKVNPVQRVVFYFAKALRERIDXeTGNSMYKGNEMSTYS--NGLSTNLTTLAFYQXTPFHSVMQY 355
                    578899**********************************************997888899888877776..33334344457************* PP

           GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlel 191
                       q Ile v  e++vH iD++i  G+ W  L++ L  R+e p   l iT+vg    + k+++eetg+rLa++Ae+l++pf+f++++++++ed++ 
  MDP0000441088 356 PGIQVILEXVVLESKVHLIDLEIRXGVXWXGLMEVLVGREECPIeLLTITAVGV---TGKQKIEETGRRLASVAEALNLPFQFKAVIVTDMEDVKD 448
                    ***************************************97665499*******...68************************************* PP

           GRAS 192 eeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvEr 287
                    + ++vk +Ea++V     l ++ ++  +le+    ++++ + l P v vv+e ea+hns+sF++rf++al yysa+fd+le+   ++++ r+ +E 
  MDP0000441088 449 QLFDVKDDEAVVVYAPXILRTMISRXSCLEN----LMRVXRXLTPCVXVVIEVEANHNSPSFVNRFIDALFYYSAFFDCLETC-XKQEKXRVLMEX 539
                    **********************988888887....**********************************************99.566677777776 PP

           GRAS 288 ellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                      l++ i+n+v +eg+er+ r  t+e Wr+ + +    +++ls+ a  qa l+ +k++s   +++ + ++l+ gWk+ p+ s+SaW+
  MDP0000441088 540 L-LHEGIRNIVVAEGSERVVRSVTMEVWRAFFARXRXVEINLSNXALYQAXLVAKKFGSPPCTLDRNGKCLIVGWKGTPIHSLSAWK 625
                    6.********************************************************999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098537.184235605IPR005202Transcription factor GRAS
PfamPF035147.7E-76262625IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 628 aa     Download sequence    Send to blast
MANAFFSFTP FDFGVLGGGS GLTSQLEXYE KEDQELKGKP DHLFGIEELG LGEMEKLSHL  60
SKDQQQSKAS YLMLDNFSFD TGCSEHDLQR SSSKCEKARS HVSKDHDHRH YQQQNQHYQQ  120
PSKSNYSDWD NFTFDSAFXS TQPIQDATNE LTXSQIGESD IAETNKQMPH QSSLAVLELL  180
NNYGSAFKNL RGDRLSNRCN EAEASXFSIQ QKLSTEEIMR VAGARYVQFS NQGYGDFFMP  240
LHPFGYALSG LSEEETKDVE LAHIFLAAAE KVGYQQFERA NRLLLRCEFA ASFKVNPVQR  300
VVFYFAKALR ERIDXETGNS MYKGNEMSTY SNGLSTNLTT LAFYQXTPFH SVMQYPGIQV  360
ILEXVVLESK VHLIDLEIRX GVXWXGLMEV LVGREECPIE LLTITAVGVT GKQKIEETGR  420
RLASVAEALN LPFQFKAVIV TDMEDVKDQL FDVKDDEAVV VYAPXILRTM ISRXSCLENL  480
MRVXRXLTPC VXVVIEVEAN HNSPSFVNRF IDALFYYSAF FDCLETCXKQ EKXRVLMEXL  540
LHEGIRNIVV AEGSERVVRS VTMEVWRAFF ARXRXVEINL SNXALYQAXL VAKKFGSPPC  600
TLDRNGKCLI VGWKGTPIHS LSAWKFT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-2529062532375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008362179.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLM5VUD50.0M5VUD5_PRUPE; Uncharacterized protein
STRINGVIT_07s0005g01500.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.12e-50RGA-like 1